DPCstruct | MC28627
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 95 ± 16 aa |
| Standard deviation of domain lengths | 16.23 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 72.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.94 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 46.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A562WM27 | 199-274 | WSSMADSGWQAAEQAAKPVKGDETPAGLPRRVPQANLVPGSPLREERPLRIVRDAARIAENTTGYFRGWRRGQEIG |
| A0A7J5C8L6 | 1-108 | PAAAVPPPAPAPPPIDPEAWRTAADEGWSRASKAAEPSNAGTTRSGLPKRVPQAQLVPGGIEPKGSRAAARRTPDEVRGLLSAYHRG… |
| A0A6F8Y1T3 | 330-416 | None |
| A0A1Q9UYJ3 | 348-446 | None |
| A0A7R7DJZ3 | 489-614 | None |
| A0A6F8YGU4 | 144-223 | None |
| A0A6V8KDR4 | 793-880 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.