DPCstruct | MC28621
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 167 ± 14 aa |
| Standard deviation of domain lengths | 14.45 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 68.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 58.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P2KGP7 | 1-162 | MNQSPFKLKGGWTLMDVSTATILQKKLLESRQVNSRDLTFKDTQIKSWYKSVFVTQKGNTVGGGTSSILNGLAAYLRDLEGTARNDW… |
| A0A5A7PQ88 | 264-411 | KFSAETLLQRKKLRGNPDLKPLELESGSKASKRKRSEKSVFVTSQGSFVGGGSSSVLNGLAAYLRYLEGTARDEWQEVHEKLRLAEK… |
| A0A287S082 | 1-185 | None |
| A0A438DIL7 | 191-364 | None |
| A0A6G1EI24 | 78-276 | None |
| A0A7J7CAE3 | 243-387 | None |
| A0A287S0M4 | 1-167 | None |
| A0A0D3H9B4 | 36-201 | None |
| A0A287S0G0 | 159-323 | None |
| A0A453LF10 | 127-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.