DPCstruct | MC2862
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 356 ± 33 aa |
| Standard deviation of domain lengths | 33.11 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 21.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A2KLV6 | 156-519 | FLDYYLAAPIKKNHTFALSQSNNLPFRRLAVEETMWESKMSFTVPRELLKLFRRWNLEMCALLESRQMEWPCSSRRCVEQCLRLYRE… |
| A0A183PE51 | 4-347 | LRSVCDNLLSKRYKFQDSIGETMHIIEFMGESKLCYAFPIEYLKTLIQSEYLIYDSLSRTGSVSFVLNLGFKMCASLVSIYHSLILV… |
| A0A1Y1XRQ6 | 87-458 | None |
| E4Z6B4 | 15-332 | None |
| A0A183K8M8 | 233-620 | None |
| A0A6J2U2B0 | 31-390 | None |
| A0A4W6EWU1 | 115-464 | None |
| A0A6G0HJV2 | 298-721 | None |
| A0A336MS64 | 333-611 | None |
| A0A817VKN0 | 57-411 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.