DPCstruct | MC28617
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 72 ± 8 aa |
| Standard deviation of domain lengths | 8.12 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 56.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02631 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q0J981 | 210-276 | HSNQTMYGISEDSMDHLFEQAAKQWQRGQSLPLENRRARVVRWLQYRGFNWAVTNAIVRKLEAQKPP |
| A0A2P2KDS8 | 1-80 | MEKAIKLVFEDEFGDDESIFGLSKHSMDHLLVQASKQWLRGQDVPNETRKSRIIRWLQYRGFNWGVISFVLKKLESQHPP |
| A0A804QR93 | 273-350 | None |
| A0A165YY30 | 265-344 | None |
| A0A453DC88 | 1-54 | None |
| A0A2P5CLI2 | 1-72 | None |
| A0A444GFF9 | 33-104 | None |
| F6I584 | 165-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.