DPCstruct | MC28616
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 195 ± 21 aa |
| Standard deviation of domain lengths | 21.23 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 21.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14661 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C7NDH5 | 3-162 | YISILLLNLALLGFQSHAITVDEQIFSRSRVNQRAFEIISHFLFSLIDPQRTHACFEHCWPIQNQAASRRYMQLAYQWLNELRYKHD… |
| A0A2P2KB89 | 13-192 | LESAMYTNCLLLGMDPNIIGLGASNGTPRVGLFRHSNPKLGEQLLYFILSSLRGPAQSAKDFDKVWPIFDSAQSRDFRKVVQGIISE… |
| R1E6V0 | 27-232 | None |
| A0A4V1XUU0 | 392-610 | None |
| A0A4U0VF67 | 35-248 | None |
| A0A438NF13 | 1-189 | None |
| T1FEY1 | 2-178 | None |
| A0A835HC20 | 2-232 | None |
| A0A452IP24 | 2-207 | None |
| A0A4U0X4R7 | 31-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.