DPCstruct | MC28612
Metacluster Properties and Pfam Annotations
| Number of structural domains | 121 |
|---|---|
| Mean domain length (aa) | 167 ± 38 aa |
| Standard deviation of domain lengths | 37.60 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 82.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.68 |
| Pfam Score | 80.67 |
| Assigned Pfam label(s) | PF00700- PF00669 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J8S803 | 5-181 | AISTSMTSQIRGMSQGIRNANDGISLAQTAEGTLSEVGNMLQRVRELAIQSASGTYQTSDRAAMQQEVSALTTQINDSFTQAKFNGN… |
| A0A800CBX0 | 34-187 | TQLTAEITRVVDSAKFNGVDLLNGAAATVFQVGQDNGETITVTSQDMTGLAAYTAIDVSTQGAAQTALTTLDGDIDSVSAARSTFGA… |
| A0A7W5FG17 | 2-263 | None |
| A0A6N8F7M4 | 18-156 | None |
| A0A7C5GCM5 | 124-284 | None |
| A0A7C8LRM0 | 138-286 | None |
| A0A0N0FSD8 | 27-189 | None |
| A0A7M1U521 | 141-235 | None |
| A0A848CZM1 | 240-385 | None |
| A0A3B0C3R7 | 1-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.