DPCstruct | MC28611
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 114 ± 14 aa |
| Standard deviation of domain lengths | 13.65 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 38.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N2ALC6 | 1-86 | MPISFSHAGAAYPGTHRAALGCTSCHKANSEAVTWSTPAYAPDCAGCHAGDYKPGEHKNASVSSLRNCAGTCHKSSPEHRVSDRDW |
| A0A7Z9UQ85 | 17-120 | PIDFSHSSPAYPGDHAGNPDCTTCHQGNSETVIWASPAYKPDCAGCHANDFKPGPHKQHENPDHSYTVSELRDCSGACHMYTNSSLT… |
| A0A521QFF4 | 140-278 | None |
| A0A370DN42 | 2-94 | None |
| A0A6N7B4B5 | 184-307 | None |
| A0A1F6T7G7 | 146-261 | None |
| A0A4R1HCQ5 | 434-554 | None |
| A0A2E9JXC8 | 666-784 | None |
| A0A7C5PZ70 | 115-233 | None |
| A0A0S8DNH2 | 555-654 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.