DPCstruct | MC28608
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 201 ± 38 aa |
| Standard deviation of domain lengths | 37.50 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 22.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21074 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z9QI16 | 30-233 | YRATRWFLRHRAQWTDIEQTTRHFQPGVRELVEHLPRLLAASAQSSLSQFVQRMTEAGVPESLSCQVAGLRLMSAGLDIIEVAHNST… |
| A0A850DK23 | 232-462 | RSLWRRIRTAPMPTAVRDELELETKRTLDRASRWLLNNRPQPIAIGADINRYSTGVRELALSVPGWLRGYHVTDLVERSRSSIERGA… |
| A0A7Y2TR21 | 74-304 | None |
| A0A1A8XVE0 | 3-158 | None |
| A0A7C8DPU6 | 159-391 | None |
| A0A0S8HBM4 | 149-304 | None |
| A0A800AS75 | 405-623 | None |
| A0A534BXF7 | 227-432 | None |
| A0A3B9BGU7 | 1-142 | None |
| A0A120G7T4 | 39-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.