DPCstruct | MC28605
Metacluster Properties and Pfam Annotations
| Number of structural domains | 105 |
|---|---|
| Mean domain length (aa) | 157 ± 26 aa |
| Standard deviation of domain lengths | 25.98 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.03 |
| Pfam Score | 99.26 |
| Assigned Pfam label(s) | PF01866- CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M0BR21 | 4-145 | FDFEEERIKQEIAKLSAKRVLLQIPQGLKPEGPRLAKIIEKTGALPIISADPCYGACDLATSEAKSLGIDLIVHFGHSKLLKHEQVT… |
| Q5DGP3 | 17-174 | EDSLLNKSISECLPVHYNFEIHKTIWRIYCLRAKNIALQMPEGLLLFAIPISEIIRNYFLRTDKLSRSTLPITTNGTTVAENNIRDI… |
| A0A1X7SU67 | 1-111 | None |
| A0A0L9UPD8 | 6-160 | None |
| A0A1I7YT80 | 139-311 | None |
| A0A6G3MJY9 | 22-140 | None |
| A0A3Q2PNJ5 | 17-175 | None |
| V6M2J8 | 5-146 | None |
| A0A830HXW2 | 12-168 | None |
| M7C0G0 | 5-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.