DPCstruct | MC28601
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 378 ± 36 aa |
| Standard deviation of domain lengths | 35.65 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.68 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF19256- PF14443 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q5DC42 | 39-389 | EKDRRRLERLYRLGDKPAIVIHPNKSAKGGRFDCHRVSLFSLLDYRTEDQKEHNFEVSLFAEQFHEMLQRDAAFTIFKAIHDAPEKE… |
| A0A183CCW5 | 572-966 | DKTDEKGKESKTQDDKKIESENNKPKFEKKERKLALERHYNLIPKNEPGIFVYPSKTAKSGRFDCKLMSFHSLLEYNKEHDNKEASF… |
| A0A6P6KVF6 | 279-638 | None |
| A0A0N0U5T9 | 608-1018 | None |
| A0A183VXI4 | 276-650 | None |
| A0A834DU33 | 149-493 | None |
| A0A1I8IR52 | 45-409 | None |
| A0A6L5CC30 | 311-663 | None |
| A0A2R7W939 | 1-326 | None |
| G5BWD8 | 56-381 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.