DPCstruct | MC2860
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 297 ± 38 aa |
| Standard deviation of domain lengths | 38.24 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 92.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 42.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0369- CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C9SJ23 | 113-420 | CYDIPGHGKLVYAGLQGWWSLLKDIIPENNLAHPLCQHLRDGQWALDYIVGRLERAAKKPGQEALKKPADWFQERFDALRQIPSFLL… |
| A0A183PBC8 | 1-348 | MLHLFYFRHPSFSPFKKKNISNVLQGIRDRNDLGHPICSHLRQGDWLAHYLTERLAKLPHNSNKLITEAIIQMSDILKIMYKPLSNI… |
| A0A3P7E7H1 | 412-686 | None |
| E9IFN1 | 62-381 | None |
| D8LWI1 | 531-730 | None |
| A0A0R3RCE9 | 1-257 | None |
| Q9W2H8 | 1028-1338 | None |
| A0A811WAF5 | 225-535 | None |
| A0A6I9P769 | 423-739 | None |
| A0A1U7LJZ3 | 562-866 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.