DPCstruct | MC286
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 246 ± 31 aa |
| Standard deviation of domain lengths | 31.03 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 72.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.04 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0010- PF00429 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A493TP75 | 42-238 | SFRTFFMLVTEQSPHQLYKWSLIRWNDQTIIKEVTTAGAPSFLTSLCQLAPISPCLNQKGFYFCPSSNPGRGYCDYPNSYYCAYWGC… |
| Q9J054 | 1-273 | MEGPTHPKPSKDKTFSWDLIILVGVLLRLDVGMANPSPHQVYNITWTITNLVTGTKANATSMLGTLTDAFPTLYFDLCDIIGNTWNP… |
| W5PRK2 | 54-342 | None |
| A0A674GTV4 | 23-274 | None |
| Q8BI48 | 1-269 | None |
| A0A4X2JLX4 | 11-223 | None |
| K7E2R7 | 6-246 | None |
| M3Z7W6 | 5-279 | None |
| G3GWL9 | 1-262 | None |
| A0A2I0MRZ1 | 44-284 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.