DPCstruct | MC28598
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 56 ± 4 aa |
| Standard deviation of domain lengths | 3.83 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 45.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9UTC7 | 1-48 | MIGDGATDLEARQPGGADLFICYAGVQMREPVVVEADWVVFEFQELVA |
| Q5BTF5 | 1-64 | MEKLHTSVMIIGDGMTDAKACPPADVFVGFGINVIRPEVKNMCHYFCTSMDELINLLEDHKILK |
| A0A7S3U928 | 161-214 | None |
| A0A4S2LM67 | 61-119 | None |
| A0A183S011 | 1-56 | None |
| A0A5P1FCI9 | 57-111 | None |
| A0A556UY66 | 739-792 | None |
| A0A7J7QBF9 | 114-168 | None |
| A0A821FAL4 | 26-81 | None |
| A0A564YQ03 | 120-180 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.