DPCstruct | MC28597
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 102 ± 3 aa |
| Standard deviation of domain lengths | 3.36 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 86.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 31.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D7ANC4 | 1-102 | MPNEQNLIPMDQRSQKEARELGREGGRASGEARRRKKSLREAAELYLSLPVSDKRAWNKLAKDGVAPEDVDNQMAIIAGLSIKAAKG… |
| A0A6D2LSI5 | 1-99 | MANEDNLIPITQRTTSEQREIQKLGGLASGKARRQRADLKRAFEILLSSEVNNEQMRELLIQLGYDPTNEMALVLVVLQKALNGDMK… |
| A0A1C5SYL2 | 1-102 | None |
| A0A1C6DY21 | 1-100 | None |
| A0A847Z791 | 3-100 | None |
| R6A759 | 4-110 | None |
| A0A6L5X2E0 | 1-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.