DPCstruct | MC28595
Metacluster Properties and Pfam Annotations
| Number of structural domains | 222 |
|---|---|
| Mean domain length (aa) | 105 ± 24 aa |
| Standard deviation of domain lengths | 23.64 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 84.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q0SVV8 | 11-96 | YLMKRLVGHGYSPNMKLEAVDLMEPRLVCVATVKRCVGRLLLIHFDGWEDEFDQWVDHQSPDIYPIGWCELMGYQLQSPPGLGKHH |
| A0A4W2C4L3 | 294-384 | GYTKLPFKWFDYLRETGSIAAPVKLFNKDVPNHGFRVGMKLEAVDLMEPRLICVATVTRIIHRLLRIHFDGWEEEYDQWVDCESPDL… |
| A0A819NAP6 | 1-88 | None |
| A0A2B4SQX3 | 341-450 | None |
| A0A2B4RZ66 | 296-378 | None |
| A0A0V0QUG1 | 408-496 | None |
| A0A3Q0IMP7 | 80-181 | None |
| A0A820KNJ3 | 34-200 | None |
| A0A817Q7V3 | 164-263 | None |
| A0A3Q3G463 | 79-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.