DPCstruct | MC28592
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 338 ± 25 aa |
| Standard deviation of domain lengths | 24.88 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 76.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.33 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 13.77 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF10539- CL0178 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843KD03 | 2-305 | NYWLFQVMYDLYPESWNSMIEMQIAAQHYPLSRNWIGAKRNNNALRKLKEGDAIVASFTNHRFAGYGILRSNFYIGGHSLKIMHRYT… |
| A0A1H9B8F5 | 3-315 | NAQLVLQPRGGSRHNGPQNFERSVRRGVRISDIASELGDDLAALSRLFPDGIARLWGSTPTASTGNAKAVALRNRRAGDRILFYADM… |
| A0A6H0KRA2 | 4-342 | None |
| A0A518SEP1 | 97-411 | None |
| A0A7S1V3Z5 | 38-368 | None |
| A0A7S4FRD9 | 3-339 | None |
| A0A1V9YD59 | 197-584 | None |
| A0A7X1GV15 | 375-693 | None |
| A0A2E0UGE3 | 113-469 | None |
| A0A1Z5KER8 | 220-592 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.