DPCstruct | MC28586
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 60 ± 7 aa |
| Standard deviation of domain lengths | 6.78 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 30.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4CAD4 | 1-57 | MKKILHIISSPKKANSASRVLGKKVAEKLKEKFQHVEIKEYDLNTIPHLSESHINAF |
| A0A4Y3M6M3 | 1-56 | MKLLHIDSSILGDSSASRHVSAAAVAQFRKKDPSVEVISLDLASDPLPHLDVEALS |
| A0A7C3KJV7 | 1-58 | None |
| A0A844MR79 | 1-57 | None |
| A0A381EW68 | 1-78 | None |
| A0A0W0MII8 | 1-59 | None |
| A0A8B5JDB2 | 1-60 | None |
| A0A4R4Z8N7 | 2-54 | None |
| A0A1H3L0S4 | 23-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.