DPCstruct | MC2858
Metacluster Properties and Pfam Annotations
| Number of structural domains | 160 |
|---|---|
| Mean domain length (aa) | 258 ± 40 aa |
| Standard deviation of domain lengths | 40.47 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.37 |
| Mean intra-cluster sequence similarity (%) | 10.12 |
| Pfam Score | 29.98 |
| Assigned Pfam label(s) | PF04381- CL0063- PF13092- PF15969- PF19614 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D7XY29 | 30-366 | RPIIASLGLPTGRGREATNEKILESLIDLKSKDRQKFDGIMANVNDLILGQVVYGEKAIFSLTVDNSVIKTLNDRFSFQWNLMNQPS… |
| E7QYB4 | 15-272 | VKDTYSGKIFQLASTSEELNFDLLKEHLTNRTIHLDPPDDYLDKEDLEVPRVFTDESGDIKIVTTIEEVRHVETSEFEALTGSIVLD… |
| A0A1Q9SLE2 | 16-274 | None |
| A0A6M1YHG9 | 7-304 | None |
| A0A3M1CVN9 | 83-403 | None |
| A0A5C5YEE0 | 129-465 | None |
| A0A177ULJ5 | 362-665 | None |
| A0A6A9SCZ1 | 3-217 | None |
| A0A7U8V9Y2 | 2-211 | None |
| A0A1Y6FAI5 | 7-238 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.