DPCstruct | MC28570
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 57 ± 7 aa |
| Standard deviation of domain lengths | 6.96 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 45.37 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0363- CL0481 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V6HSV5 | 124-178 | RTCFTAGTLVHTKSGTKKIEEVKVGDQVLSWDEESGEVSYKAVTELFVHDINHLF |
| R6SHV3 | 10-61 | MIQCFIAGTLVATKSGLVPIEDIQPGDLVWATDEETGETSLKEVVQNFRNET |
| A0A1I3BMG0 | 13-66 | None |
| A0A374E816 | 64-124 | None |
| A0A0L0KP43 | 46-105 | None |
| A0A374BL47 | 39-98 | None |
| A0A7U6QMW1 | 1-71 | None |
| A0A4S4BGK3 | 93-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.