DPCstruct | MC28566
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 328 ± 25 aa |
| Standard deviation of domain lengths | 24.95 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 62.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07891 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A445DL12 | 1-308 | MDFLKIKKFRKSQKADGGKDLVNKDVLEPEEPKPNSGGPDQCKSVNADPVAETEDDDDFITNEVKRRLKELRRNSFMVLIPEEDSCP… |
| Q6L415 | 359-683 | DFQESPNHNSSRKSWDTDGFASQNVDRIEETDVNYEDMNDFQDSPDHNSSRKLWDTDSDSDDDDDILIEHQNLVRQMKMEMKNSRIT… |
| A0A6I9UIJ9 | 113-475 | None |
| A0A166B4A2 | 58-361 | None |
| A0A072TS85 | 1-363 | None |
| A0A2P5AAB7 | 305-632 | None |
| A0A7J7M023 | 454-792 | None |
| A0A6A2YKX7 | 104-461 | None |
| A0A426Y6M4 | 1-333 | None |
| A0A6I9S3K0 | 833-1158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.