DPCstruct | MC28563
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 142 ± 22 aa |
| Standard deviation of domain lengths | 21.88 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 30.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07920 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z0CYI8 | 124-269 | YDPQAPAHRAFRGVPAYPFDPDWVVPARFEEYPTPRSITVAGAQTGLEHQREAIGEAVFERDGSHHRLIIFGDHGTTILFADITSGA… |
| A0A841DUT6 | 30-157 | SIVAFDWLSSAPTGLQGLPGQWWADERAHVSASGELTLGGEDRAYELVATAAGDSRLNLSFHDRTNGAETAPWRTVTTGPVARDGSV… |
| A0A6N9H998 | 127-273 | None |
| A0A2J6HWF9 | 1-97 | None |
| A0A537G385 | 2-114 | None |
| A0A0K2R4N3 | 220-377 | None |
| A0A521S2C3 | 17-166 | None |
| A0A4P6ELS0 | 18-166 | None |
| A0A7Y3AP57 | 265-415 | None |
| A0A2K9C4M6 | 4-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.