DPCstruct | MC28560
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 77 ± 6 aa |
| Standard deviation of domain lengths | 5.59 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15615 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D1WU49 | 1-80 | MPEQAAFGLSAEETDILHILLAGENPASYIRAHHLYPAVVADSINEKLFEEIGDSAVMEEDGTLSLIEDYLDDLRFLLPQ |
| A0A645JE64 | 70-136 | RLSEHEVRALEVVLCGSDLKAFADECAVMTEVLIDAINEKAMDCIGDNLMDDEFSIYDDYKEQVKDL |
| A0A087E1R1 | 770-844 | None |
| A0A847WA10 | 214-300 | None |
| A0A4V3BIJ6 | 182-253 | None |
| D1YGT7 | 372-453 | None |
| C8PMK5 | 318-394 | None |
| A0A3G9JPN3 | 797-870 | None |
| R6YIP6 | 532-611 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.