DPCstruct | MC28558
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 93 ± 8 aa |
| Standard deviation of domain lengths | 8.44 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D1Q667 | 2-99 | RSKKSRAEGRRSDPFFHDKPTEEESLLFVGHVGVLLTAEDGTLHFVEKVAFQEPYRMLRFADRTALSDYLMGKYDTSWGQDMASPFI… |
| A0A654XX01 | 138-220 | ARMLSVVLHDNLDGEYLFVGHVGVLVPADDGFLFVEKLTFEEPYQAIKFASKEDCYKYLGTKYADYTGEGLAKPFIMDNDKWV |
| A0A416DXP6 | 269-381 | None |
| A0A0M6WK70 | 90-186 | None |
| D4JPD6 | 11-104 | None |
| A0A380M9F0 | 9-103 | None |
| A0A2S0RL00 | 52-138 | None |
| A0A1C5THT7 | 1-82 | None |
| E0NLX3 | 185-275 | None |
| A0A660N6A0 | 212-308 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.