DPCstruct | MC28553
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 77 ± 11 aa |
| Standard deviation of domain lengths | 10.97 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 37.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A7GMF3 | 11-85 | GSTGRTTAKSLEEQLAMKEVKSNPLGKPIPKIVMTDPRWPHEEGWVKMAQNVNGVEIHYAKNTKTGEFDDFKFTN |
| A0A428Y442 | 4-77 | GHTGKHKNLTINEKIAMDEVMYDPKAGEVLPITLKDPRWPAKDGWVKMAQEVNGVRIHYLFNEVTGHYDDFKVK |
| A0A1N7DCD3 | 38-121 | None |
| A0A425AZK2 | 110-203 | None |
| A0A1V3MZF3 | 353-442 | None |
| A0A483AD45 | 79-152 | None |
| A0A2N5GI14 | 1-65 | None |
| A0A4R6IDD3 | 121-219 | None |
| A0A815S4Q2 | 86-172 | None |
| B4V097 | 18-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.