DPCstruct | MC28551
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 137 ± 10 aa |
| Standard deviation of domain lengths | 9.88 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 19.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A316LHI9 | 1-134 | MAMPKLCTFIQFCYIYMGNGMTQDNFTAYLFDSIADEYDMDIPGFSENPICNKSPSALRNLFTGVSTLAPKDASWLLCHLNKEKFIT… |
| A0A7T9MT32 | 1-130 | MKFFELADALQPAVPGGLSRAPYLRELISMFTNVTEAEWTTRNDPSVLPSDATLESMASRDSAFTKKLAKAITARWGIMNFVTVLDE… |
| A0A1C5UJT7 | 23-143 | None |
| A0A2N3RRW6 | 1-141 | None |
| A0A0F5H146 | 1-131 | None |
| A0A1H7LG32 | 6-164 | None |
| A0A4Q2B6A4 | 1-134 | None |
| A0A7H9EH08 | 5-145 | None |
| A0A3A6FVM8 | 1-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.