DPCstruct | MC28550
Metacluster Properties and Pfam Annotations
| Number of structural domains | 175 |
|---|---|
| Mean domain length (aa) | 170 ± 31 aa |
| Standard deviation of domain lengths | 30.89 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 13.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0767 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M5RQQ2 | 19-177 | CSSNELYGFEQYDVESGIRIEKWDDRITFTYDPNEGNRATDFLCNDLDWFLVSNRFRNIMESNNIEGIQYLNITVENQLNQKKLKGY… |
| A0A5P6NGU4 | 13-142 | GERMSAEHFPEKIFAKYPDKMERKQSDLVLAAGAVVVSAACADVLRQFDLGHSSLYPIKLFQHDRKTPVEGEYFCLNIGERKAAFLP… |
| A0A833H016 | 64-249 | None |
| D4KVL9 | 6-138 | None |
| A0A7V7WJV9 | 60-207 | None |
| A0A3M1GVR3 | 893-1081 | None |
| A0A5C4T1D1 | 6-173 | None |
| A0A532DJR7 | 8-136 | None |
| A0A7C6D900 | 1-194 | None |
| D3Q6U4 | 1-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.