DPCstruct | MC2855
Metacluster Properties and Pfam Annotations
| Number of structural domains | 66 |
|---|---|
| Mean domain length (aa) | 182 ± 37 aa |
| Standard deviation of domain lengths | 37.20 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.55 |
| Pfam Score | 79.71 |
| Assigned Pfam label(s) | CL0123- PF15915- PF19020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2SFF1 | 6-197 | YILEVIYKIPCPWVSLVGREAKILSCRPWGEKGSRVMIRFGRSIDSESLKKRGVIVSSIYRMRDGHSIAFIRSKACPCRISGLNEAH… |
| E7QP85 | 9-205 | VADFVPGSGGGIPAQISVEAERAGEVDDWPHLSQTLQTTSHTYYRLSGFGQAIDDGGVSCSSCRNCTVTTCLLNRFPSLPADPYEVS… |
| U1QI42 | 7-128 | None |
| A0A343TKU8 | 4-144 | None |
| A0A2R6CWA8 | 799-1005 | None |
| A0A343TKD9 | 28-164 | None |
| A0A6B0GLZ8 | 1053-1262 | None |
| A0A6B0GKV5 | 734-947 | None |
| A0A7J2V107 | 3-105 | None |
| A0A256K4H0 | 10-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.