DPCstruct | MC28545
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 184 ± 16 aa |
| Standard deviation of domain lengths | 15.60 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09482 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G6UA57 | 6-197 | TAVSTTDRILYDPASYLHASRLNPRMSTRCAGQRAALSRIVMAVYGLSDGPAPPRTPADRTLADCWWELPIVCMLAGAHCLRGELIG… |
| A0A410X874 | 3-182 | LTTKQFELFSGVMYDPLSYIHSSYPTLASTSDHLVWQKIANSKLIKQYNLMTELDCPINGITEKIINYWHLLPRCALFLGYFYSRNF… |
| A0A6D2G636 | 1-159 | None |
| A0A2Y0G0F7 | 1-159 | None |
| A0A2X7F263 | 1-181 | None |
| A0A845SJJ8 | 2-187 | None |
| A0A7W8KKZ4 | 3-177 | None |
| A0A1N7SCE0 | 11-217 | None |
| A0A4Q2J6G6 | 79-281 | None |
| K9NNK0 | 1-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.