DPCstruct | MC28542
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 359 ± 92 aa |
| Standard deviation of domain lengths | 92.43 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 86.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 26.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0032 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V2WGF0 | 31-399 | IQGDILVGMKKDKELFFFFGIQDAATFKAKLGSDIHNLITSTTQLLDVSLQPVTAVNIAFSQTGLKALGNSDDLKDRLFQAGQFNDA… |
| A0A2N5SJ77 | 43-390 | TWSEDFQVNSIDLVVLITASDSSLLNEKLNQVRYNLNEFLSSSFLRQGKVRPGSQRGHEHFGYLDGITAPKIEGINDKPEDKKEGIV… |
| A0A0H2RS85 | 270-730 | None |
| A0A3M7HEI1 | 57-448 | None |
| A0A5K1K3L4 | 6-213 | None |
| A0A0C9TQH4 | 11-251 | None |
| A0A1L9VSX1 | 280-505 | None |
| A0A4E0QFP9 | 410-807 | None |
| A0A1A8ZQ75 | 75-494 | None |
| A0A6J6RUT0 | 121-552 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.