DPCstruct | MC28538
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 101 ± 12 aa |
| Standard deviation of domain lengths | 11.72 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A180FZW7 | 3-91 | DVIPQHRMVRIVPQDRDLGFDGTDVEKFLDLYERAARINGASEYDMARQLRLFICSDEVFDMMETFEGFKNHRWPDLKASMLAYWGQ… |
| A0A2N5S3T9 | 59-168 | LPEEGEFTGLIDAKKANITFDGTDVEGFIKRLENIASILKCGSISLARQLPYIINNNKIGRSIELMEGHETGDWELLKKSLLRKWGR… |
| E3KAX9 | 42-147 | None |
| A0A0L0VEJ8 | 77-176 | None |
| A0A0L0VJ72 | 1-97 | None |
| A0A0L0VW90 | 229-337 | None |
| A0A2N5S254 | 40-140 | None |
| A0A2S4WBW8 | 2-80 | None |
| A0A2S4WI32 | 2-98 | None |
| E3JWF8 | 1-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.