DPCstruct | MC28536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 96 ± 13 aa |
| Standard deviation of domain lengths | 13.44 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N5RWN2 | 1-88 | MEPINIPKRILNYDDETLKKEIENDAFKRYAQTSKPLQVDTVLNLIRGRNTFLLAATGFGKSRIPEIFTSNISASRSSIVEGKPLEGH |
| A0A5B0LPU0 | 5-97 | NIPKKICEYDDDQLKDYIKNESFNRYKQESKPLQVKTVANLVRGRNTFLLAATGFGKSRIPEMYLNLTTRDRKGELLGVVVVLNPLD… |
| A0A2N5S4Z8 | 96-190 | None |
| A0A2N5SI73 | 6-106 | None |
| A0A180GUX8 | 3-98 | None |
| E3JSM9 | 27-135 | None |
| A0A2N5V199 | 90-192 | None |
| A0A2N5VC92 | 44-158 | None |
| A0A180GA60 | 20-124 | None |
| F4RGM9 | 10-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.