DPCstruct | MC28534
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 154 ± 37 aa |
| Standard deviation of domain lengths | 36.67 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 76.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 20.76 |
| Pfam Score | 76.90 |
| Assigned Pfam label(s) | PF17406- PF17407 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A673LLJ8 | 666-800 | DDVLIHLDSKQVPMLAKAVDPPANTFLQGTHRGEPFTSGGALPVIDYDPVRLYLSELREAFGDLVLFFYDPYGGTVIAVLWKPAAFE… |
| B3LID6 | 854-1028 | TRLTALAKVAVNLLQTHGLNQQTINLLFTPGLKDYDFVVDLRTPIGLKSSCGILSATEFKNITNDQAPSNFPENLNDLSEKMDPTYQ… |
| A0A1A9UX07 | 11-138 | None |
| A0A5M9JD81 | 31-167 | None |
| A0A0R3W3R6 | 459-690 | None |
| A0A818HK33 | 1021-1171 | None |
| A0A1I7RWB3 | 512-673 | None |
| A0A817D835 | 199-346 | None |
| A0A815Q8X9 | 701-850 | None |
| A0A6P8S801 | 353-522 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.