DPCstruct | MC28528
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 74 ± 16 aa |
| Standard deviation of domain lengths | 16.35 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 83.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 42.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S8UFV3 | 1-72 | MSKRKRTSKIDKWIKEGRGTGSGADYQPWLKIQDVSSIGRSTRLKGIKTARQHEFLSNLERDSFKITEYSDD |
| B7CCB9 | 82-169 | HKRKIEEGRCQGYGKDYTPFILVREYKGRGTASVIWDPFEERLIHCLSQTEVAVYETIRWQDNVEHIREQYLLDTDRMNAIAEELGMK |
| A0A2N5C3S8 | 62-163 | None |
| A0A1V4HH69 | 9-69 | None |
| A0A2W1KJV2 | 4-71 | None |
| A0A177KY78 | 1-69 | None |
| A0A1B8WI88 | 1-69 | None |
| A0A1E1VH36 | 1-67 | None |
| A0A2X2WDF2 | 1-67 | None |
| A0A069RBD4 | 1-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.