DPCstruct | MC28527
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 97 ± 12 aa |
| Standard deviation of domain lengths | 12.28 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 71.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 23.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5DHA5 | 33-107 | NSPTQNYSPTYIKAHRKHLSLDTLFYYDLPFQFDSNDQDHIIITRELNAEQTDILFEHSRRHRRNLPSLIRTRQH |
| T0KXC9 | 1-107 | MWTEITKDLVIRDAIIELGYDFEETEYFFYIMQYLKYDDVLELVKVSDEIRQFRKHRVREIEYEKEWRDDWDRRHGHHHHHRLPSKY… |
| A0A317SYD6 | 47-165 | None |
| A0A365MMB4 | 282-391 | None |
| A0A4Z1I1Z4 | 71-147 | None |
| A0A0S6XJU5 | 87-200 | None |
| A0A6A6AKF3 | 875-965 | None |
| H0EX75 | 276-371 | None |
| C4JTM5 | 348-443 | None |
| A0A194XF73 | 182-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.