DPCstruct | MC28526
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 298 ± 16 aa |
| Standard deviation of domain lengths | 15.56 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 71.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J9W3I3 | 7-308 | VGDLISLGRLAWEVYRYGWSEDHNATKQYEEFGRDVRGLAENLDILSRVVAWADNSLQSQRRQGAPAKLRWDRMSLVQIIGDYEMTL… |
| T0KQC1 | 1-322 | MFSGETHEVPKVTLCAKAENLGLPSQEDNLLNLALSTGDRSEWCPLSLDLPPTKQYEEFGRDVRGLAESLDILTRVVSQAEQSLRRD… |
| A0A4T0VHP6 | 14-303 | None |
| R1GJB6 | 1-288 | None |
| A0A6A6C3B6 | 7-308 | None |
| R8BM21 | 8-319 | None |
| A0A517LQD0 | 7-311 | None |
| A0A177CQV5 | 7-301 | None |
| A0A0D2F3T6 | 25-285 | None |
| A0A4U0TN09 | 5-307 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.