DPCstruct | MC28524
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 216 ± 34 aa |
| Standard deviation of domain lengths | 33.66 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 37.49 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF12660- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A086TCQ8 | 492-698 | SDTDDEFQEEAGKSTIKVHPWRFRFWGLASSPGDGSTVALVSKHSAQLPSRRGLSKLVFGSYPTTQQGAAEDQAPGLSTEGRMWEWM… |
| H1V3W6 | 1-205 | MSPAGGMSAVLVSQHATQKPEKSVKTKVMFDARSGPAAAALPDPRLSDDAMDVDGGEGSAAGPGRSEGASWARQSTEAKMWDWMYAS… |
| A0A0B7JNG8 | 1-182 | None |
| A0A0L0NGU1 | 284-499 | None |
| A0A0I9XN15 | 318-517 | None |
| G2Q1M2 | 58-345 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.