DPCstruct | MC28523
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 154 ± 11 aa |
| Standard deviation of domain lengths | 10.62 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 50.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11735 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0KFK4 | 1-155 | MEPVKVKSCWNGMVVFDAAPFYDDGLRFRGSDDSLAAKHLEGSECCLIHADNPLSREKGVWLNPNVRVGYNERVFEQTKMDRFPTPW… |
| A0A0K8LG41 | 468-616 | PVPVKSCWNGMVAMPIEPFVSATPLRFRGISDSLALFHLEGSECCLIHADNPLSGHQGVYLNPKVRVGYNGEAYEKVHPAGSWLSPQ… |
| A0A135TLG5 | 202-364 | None |
| G2Y146 | 161-326 | None |
| A0A7R7WEF1 | 72-220 | None |
| A0A2D5SEK7 | 74-249 | None |
| A0A0A2K7H0 | 594-742 | None |
| A0A093VE88 | 699-859 | None |
| A0A1V6QGG2 | 364-508 | None |
| A0A100IC36 | 494-637 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.