DPCstruct | MC2852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 190 ± 18 aa |
| Standard deviation of domain lengths | 17.59 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 19.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V3CBP8 | 2-162 | TTLTFPIGHCLGTVHAAGSHVQQVRLGGEIVDLADEEFAVWALAHALTGGRGPLIDSLLARNLLVEVDVNNPAGFAERHRLLPLNLG… |
| A0A1R4F4Y2 | 231-434 | PADPTRVPELHRIGWDLGFALVDGGSVWRIVDRGHVIIEMSREEYVVWTSAAGRPATVDGSWTLADANERAQSLAVPRPEPILRALL… |
| A0A0F0GJD1 | 2-153 | None |
| A0A2W1TN39 | 8-209 | None |
| A0A8A5YT29 | 224-408 | None |
| A0A846B0A2 | 8-194 | None |
| A0A2S6IP07 | 23-222 | None |
| A0A2T0ZZT6 | 10-212 | None |
| A0A2G6XDW3 | 295-501 | None |
| A0A2W6C882 | 1-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.