DPCstruct | MC28519
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 142 ± 27 aa |
| Standard deviation of domain lengths | 26.68 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 42.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A455U708 | 1-191 | MTEQGEMIRFKFGQPDIALRSMEIYACAVLEATLLPPRTPEPHWRDEMDQLAKVAHGAYVGVVREDPDFVPYFRAVTPEGALGRLPL… |
| A0A6A3BU54 | 327-470 | TVQGEVIEQSFGEEHLCFRTLQRFTAEHGMHPPVSPNPEWRELMDEMALVATKEYRSVVFQEPRFVEYFRLATPELEYGRMNIGSRP… |
| A0A3S4U7F7 | 403-583 | None |
| A0A3P6FJL8 | 403-507 | None |
| A0A430CJE9 | 241-374 | None |
| A0A378N905 | 1-132 | None |
| A0A0D3ADJ4 | 397-507 | None |
| A0A4Q3WR27 | 421-557 | None |
| A0A396JKK5 | 145-310 | None |
| W7WR86 | 260-390 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.