DPCstruct | MC28518
Metacluster Properties and Pfam Annotations
| Number of structural domains | 159 |
|---|---|
| Mean domain length (aa) | 148 ± 24 aa |
| Standard deviation of domain lengths | 24.36 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 87.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 32.16 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | CL0270- CL0603- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L9VTZ7 | 12-152 | KDSTSTRPAIFAMSNPTKNAECTAEEAFSVLGDNIIFASGSPFSNVDLGNGHIGHCNQGNNMYLFPGIGLGTLLSGASIISDGMLQA… |
| R4V1I1 | 82-219 | KGADVFIGVSAPKCVTPEMVKSMAKDSILFPMANPTPEIFPDEAKAAGASIVGTGRSDFPNQINNVLAFPGVFRGALDVRASDINDE… |
| B5IJQ0 | 650-810 | None |
| A0A6D2HEF4 | 808-975 | None |
| A0A3D3GFF0 | 376-543 | None |
| A0A838JWL7 | 4-107 | None |
| A0A0D2NQY7 | 139-270 | None |
| A0A7V2XLU2 | 35-185 | None |
| A0A6D2JFL9 | 145-267 | None |
| A0A6J0PDT0 | 26-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.