DPCstruct | MC28514
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 75 ± 6 aa |
| Standard deviation of domain lengths | 5.79 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 43.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0118 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N2MGN3 | 3-75 | SEGILLGMGNPLLDISSVVDDDFLKKYDIKLNNAILAEDKHLPMYEEMASKGNVEYIAGGATQNSIRVAQWML |
| A0A5E4NT85 | 3-73 | SGYTVGRSNIVKPGAIVGFCNPLLDMTVVGNQYLLNKYGLKKNDAILAKEEHMPLYDEILKDNNVDFTAGG |
| A0A2N5STK7 | 1-65 | None |
| A0A482SH37 | 32-106 | None |
| A0A1S3FYE2 | 165-254 | None |
| A0A6A6L612 | 1-72 | None |
| U6KN09 | 2-68 | None |
| A0A1B6IH27 | 2-76 | None |
| A0A821EWN9 | 3-79 | None |
| A0A4W5L899 | 2-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.