DPCstruct | MC28513
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 93 ± 19 aa |
| Standard deviation of domain lengths | 18.64 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 72.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 32.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00444 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7SRQ8 | 53-108 | LANPTVQQQRGFKVKKFPKLRCEHCYFIRIDGRLHVECHAAPKHKQREEFDIKTLW |
| A0A5E4NSD2 | 11-94 | AIRPSTINNTPKILSVIQSPSITSLSLIPSRGFKVFGKVRRRCKDCYLVTRDQRVYNLCKTHQKHKQMSIRHTDKAYYILTGVQ |
| B6K358 | 91-224 | None |
| A0A226F2K1 | 30-138 | None |
| A0A154PP39 | 1-70 | None |
| A0A819VE72 | 1-67 | None |
| A0A7R9AQT8 | 58-160 | None |
| A0A6S6WCI9 | 11-120 | None |
| A0A5N6U2R8 | 6-102 | None |
| A0A3S2U9Y7 | 57-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.