DPCstruct | MC28510
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 60 ± 4 aa |
| Standard deviation of domain lengths | 4.38 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 83.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 51.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21018 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S4IEG7 | 1-58 | MRASGTDEAVILVPPIKMSLEQALEFIDDDELVEVTPTSIRIRKRHLTENDRRRANRG |
| A0A847I8K9 | 7-65 | TNIRAASADKTVVLKPPRVMTLEMALEFIEADELVEVTPAAIRLRKRLLNEVERKRAAR |
| A0A6A5L2F3 | 116-176 | None |
| A0A538L908 | 2-62 | None |
| A0A7Y2VMY5 | 40-93 | None |
| A0A7K0STF9 | 3-62 | None |
| F3LH90 | 54-111 | None |
| A0A381IBH0 | 119-179 | None |
| A0A2M6YE47 | 1-60 | None |
| A0A0F3QZU8 | 30-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.