DPCstruct | MC2851
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 74 ± 13 aa |
| Standard deviation of domain lengths | 13.02 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 43.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C6DPE1 | 7-64 | YLHRQLRRAWAAQVALGGILCARCGERIDPGEPWDLGHRDGSRVEYAGPEHARCNRAT |
| A0A2E8YTL7 | 16-77 | YDAAHEAKRKQLAPIVATGCVKCWRCGRYIAATEPWDLGHDDRDRSITRGPEHRGCNRATSG |
| A0A430F7U6 | 31-105 | None |
| A0A7T6BAX2 | 4-84 | None |
| A0A1Y5PQN6 | 3-69 | None |
| A0A1V2ZEJ0 | 1-61 | None |
| A0A4V2NXX8 | 3-90 | None |
| A0A2I1IR26 | 27-92 | None |
| A0A0K1JQ72 | 1-104 | None |
| A0A2T5W6L0 | 24-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.