DPCstruct | MC28505
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 479 ± 142 aa |
| Standard deviation of domain lengths | 141.96 |
| Length coefficient of variation | 0.30 |
| Mean AlphaFold2 pLDDT confidence score | 78.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01496 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9YPB8 | 3-328 | RLEAKLGFISGLVHRAKVEAFEKMLWRVCRGNTIVSYSEVEDCLEDPDTGELTKWFVFLISYWGEQIGQKVKKICDCYHCHVYPYPS… |
| A0A674CNK8 | 9-520 | VAGVVHPWKVPSFERLLWRACRGYIIVDFREMEERLELPETGEMVQWTVFLISFWGEQIGQKVKKICDCFHTHTFDYPEGTTEREKI… |
| A0A821QEU5 | 1-306 | None |
| A0A1I8FGZ5 | 59-625 | None |
| A0A812N939 | 3-280 | None |
| A0A226F5A8 | 62-714 | None |
| A0A0N5DB33 | 56-593 | None |
| A0A7C4JMZ2 | 16-403 | None |
| A0A2H6K6U7 | 106-690 | None |
| A0A1I8FLE2 | 1-375 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.