DPCstruct | MC285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 103 ± 11 aa |
| Standard deviation of domain lengths | 10.73 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.36 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | PF01840- CL0351 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P3EZC9 | 17-114 | HPSRLWIWDKATFMDEQRRTWLPVILKSETNMQVLLRQQTVPVGDPKSPTQLGPSLLPLMWQHYPSEKRYQDSNFASWHVMYHIKFC… |
| M3WDH2 | 3-99 | ELPFFRARSALHPDHLWIWERSVYVDENQRTWLPIIIEMESSLQVLMRQEDVLLGEAVCPGLLAPGLVPSMWQLYPGRRYRGSDSSF… |
| A0A3Q7QYX2 | 6-121 | None |
| A0A2I0TU44 | 3-111 | None |
| D4A3B6 | 2-91 | None |
| S9YC40 | 1-113 | None |
| S9Y2L5 | 1-137 | None |
| A0A6J0Y047 | 5-108 | None |
| A0A6J0XZF8 | 2-111 | None |
| A0A671ECT5 | 2-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.