DPCstruct | MC28494
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 210 ± 29 aa |
| Standard deviation of domain lengths | 28.85 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F0YLX2 | 18-226 | LGQCPTFGRRNYYAEHCEIITYDAASGFAYAWLNAGPCVAGFAAATDADVVAVWPEGADPPYKRNGPRRFMTTCVGFDDAAAVAARA… |
| A0A7K0WPV1 | 2-198 | RGKRYCEVLLTTIVDGNATAEVYNSYTLNDCPEDLWNALDAKAIASAEGVPLAVLNGPRYWLMDRAEKKGGSDGLTKKDFGGIEMYR… |
| A0A6G0XKZ8 | 109-334 | None |
| A0A418VXS4 | 4-224 | None |
| A0A7Y1ZEE9 | 139-344 | None |
| A0Z9E0 | 2-165 | None |
| A0A3D5YR85 | 7-217 | None |
| A0A2E3NM58 | 27-223 | None |
| A0A845X8Y9 | 32-316 | None |
| A0A3R6YA14 | 207-439 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.