DPCstruct | MC28488
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 59 ± 2 aa |
| Standard deviation of domain lengths | 1.56 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 88.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 55.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V2P9X3 | 68-127 | SWPAVASALERAGIAHPGGFTHLVVFRRCLRCAEINVVRDGYFACVFCDADLPAEWNVTV |
| A0A1G6YRK9 | 1-58 | MAEALDRIGIDRPPGFTHEVVFRRCRSCRKLDMVREEHLVCVFCGEDLPREWNMGEHG |
| A0A3N1KJ94 | 102-160 | None |
| A0A1H4IBL1 | 237-295 | None |
| A0A239LG45 | 52-110 | None |
| A0A561RHC8 | 17-71 | None |
| A0A0M3QJ33 | 205-265 | None |
| A0A2P8AZU5 | 1-58 | None |
| A0A3N4S770 | 297-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.