DPCstruct | MC28486
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 178 ± 19 aa |
| Standard deviation of domain lengths | 18.54 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20112 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A212DMH2 | 97-273 | RTSAIVARWLADPSFVDAKGIPLPLPRASEAGEASFASLVESVTRDLRPRAVLDDWLDRKLVEIDENDRIVLMEGAMVPRGDGEVRL… |
| A0A2G1Y9G0 | 1-169 | MNLPFDGPLSFSELVRRYSGDMTPRAVLEELVRVGVVATDASGTLELRLRAYVPAGDSEEMLQIFGEDVSDLIATIDHNLVGSEGER… |
| A0A0K8NVF3 | 146-352 | None |
| A0A5C7KF70 | 1-199 | None |
| A0A424T5S4 | 118-303 | None |
| A0A7V5V437 | 77-253 | None |
| A0A521WD13 | 73-231 | None |
| A0A7C7CIA6 | 3-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.