DPCstruct | MC28484
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 202 ± 23 aa |
| Standard deviation of domain lengths | 23.06 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E9CMI3 | 9-204 | SAEGRPILMCQLVRPTGSTRIDRASLAHSHWACIDAQTFKAFWDEEVAAAEGRLDLETIWVATGLLLPVWNRLPQDDVRVWRIDNGA… |
| A0A7X7IRX7 | 1-160 | WWNAEYEKTPAREPQRFHILSGAIFPIYDKVMGSSGIRNVKIARAILVDGQALVGLNLSPADVPNVKQRLGIGTPLATASPAAILEL… |
| A0A4D8QAC5 | 455-661 | None |
| A0A1X7MSY7 | 1-266 | None |
| A0A4R2SCD5 | 749-952 | None |
| A0A2N3AXK9 | 2-197 | None |
| A0A7X4ENQ5 | 156-356 | None |
| A0A7Z8FVV2 | 74-278 | None |
| A0A4P7ZDX0 | 253-454 | None |
| A0A6P1BB88 | 31-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.